
From GPTWiki
Revision as of 15:17, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=O95445 |description=Apolipoprotein M |gene=APOM |name=APOM |sequence=MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEEL ATFDPVDNIVFNMAAGSAPMQLHL...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Apolipoprotein M
Organism Homo sapiens
Species Homo sapiens
GlyGen O95445

Samples (Peptides)

Human Serum (1 / 1)


N135 (1 / 1)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups