P01011@N93

From GPTWiki
Revision as of 20:24, 26 May 2021 by Edwardsnj (talk | contribs) (Created page with "{{ProteinSite |aa=N |position=93 |protein=P01011 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Protein SERPINA3 (P01011)
Site N93
GlyGen P01011@N93

Samples (Peptides)

Human Serum (4 / 4)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE00128072K.NVIFSPLSISTALAFLSLGAHN[H5N4S]TTLTEILK.G101H5N4S5,102.44710
PE00024363K.QLVLKAPDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G101H5N4S26,386.14430
PE00027068K.APDKNVIFSPLSISTALAFLSLGAHN[H5N4S2]TTLTEILK.G101H5N4S25,804.754128
PE00032168K.APDKNVIFSPLSISTALAFLSLGAHN[H6N5FS3]TTLTEILK.G101H6N5FS36,607.03910