P01877

From GPTWiki
Revision as of 23:58, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01877 |description=Immunoglobulin heavy constant alpha 2 |gene=IGHA2 |name=IGHA2 |sequence=ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDAS G...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Immunoglobulin heavy constant alpha 2
Gene IGHA2
Organism Homo sapiens
Species Homo sapiens
GlyGen P01877

Samples (Peptides)

Human Serum (63 / 63)

Sites

N47 (4 / 63), N131 (51 / 63), N205 (8 / 63)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE0021788K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N4F]VTAR.N51H5N4FN476,562.00410
PE0003678K.VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQN[H5N5F]VTAR.N51H5N5FN476,765.08410
PE00037425V.ACLVQGFFPQEPLSVTWSESGQN[H6N5FS3]VTAR.N51H6N5FS3N476,032.51810
PE00040426A.CLVQGFFPQEPLSVTWSESGQN[H6N5FS3]VTAR.N51H6N5FS3N475,961.48110
PE001034114R.LSLHRPALEDLLLGSEAN[H3N5]LTCTLTGLR.D140H3N5N1314,482.1572010
PE001064119R.PALEDLLLGSEAN[H3N5]LTCTLTGLR.D140H3N5N1313,875.79798
PE001425114R.LSLHRPALEDLLLGSEAN[H3N5F]LTCTLTGLR.D140H3N5FN1314,628.21510
PE001077114R.LSLHRPALEDLLLGSEAN[H4N3]LTCTLTGLR.D140H4N3N1314,238.05197
PE001393119R.PALEDLLLGSEAN[H4N3S]LTCTLTGLR.D140H4N3SN1313,922.78632
PE001036114R.LSLHRPALEDLLLGSEAN[H4N3S]LTCTLTGLR.D140H4N3SN1314,529.14671
PE001063114R.LSLHRPALEDLLLGSEAN[H4N4]LTCTLTGLR.D140H4N4N1314,441.13030
PE001108119R.PALEDLLLGSEAN[H4N4F2S]LTCTLTGLR.D140H4N4F2SN1314,417.98110
PE000776114R.LSLHRPALEDLLLGSEAN[H4N4S]LTCTLTGLR.D140H4N4SN1314,732.226168
PE000828119R.PALEDLLLGSEAN[H4N4S]LTCTLTGLR.D140H4N4SN1314,125.86663
PE001067119R.PALEDLLLGSEAN[H4N5]LTCTLTGLR.D140H4N5N1314,037.85074
PE001035114R.LSLHRPALEDLLLGSEAN[H4N5]LTCTLTGLR.D140H4N5N1314,644.210194
PE001079114R.LSLHRPALEDLLLGSEAN[H4N5F]LTCTLTGLR.D140H4N5FN1314,790.26841
PE001117114R.LSLHRPALEDLLLGSEAN[H4N5FS]LTCTLTGLR.D140H4N5FSN1315,081.36310
PE000831119R.PALEDLLLGSEAN[H4N5S]LTCTLTGLR.D140H4N5SN1314,328.94574
PE000778114R.LSLHRPALEDLLLGSEAN[H4N5S]LTCTLTGLR.D140H4N5SN1314,935.305235
PE000774114R.LSLHRPALEDLLLGSEAN[H5N2]LTCTLTGLR.D140H5N2N1314,197.02450
PE001116114R.LSLHRPALEDLLLGSEAN[H5N3S]LTCTLTGLR.D140H5N3SN1314,691.19981
PE001107119R.PALEDLLLGSEAN[H5N3S]LTCTLTGLR.D140H5N3SN1314,084.83952
PE000070114R.LSLHRPALEDLLLGSEAN[H5N4]LTCTLTGLR.D140H5N4N1314,603.183122
PE000090119R.PALEDLLLGSEAN[H5N4]LTCTLTGLR.D140H5N4N1313,996.82373
PE001125119R.PALEDLLLGSEAN[H5N4F4]LTCTLTGLR.D140H5N4F4N1314,581.05510
PE000154114R.LSLHRPALEDLLLGSEAN[H5N4FS]LTCTLTGLR.D140H5N4FSN1315,040.33650
PE001392119R.PALEDLLLGSEAN[H5N4FS2]LTCTLTGLR.D140H5N4FS2N1314,725.07210
PE000233114R.LSLHRPALEDLLLGSEAN[H5N4FS2]LTCTLTGLR.D140H5N4FS2N1315,331.43220
PE000126114R.LSLHRPALEDLLLGSEAN[H5N4S]LTCTLTGLR.D140H5N4SN1314,894.2794718
PE000131119R.PALEDLLLGSEAN[H5N4S]LTCTLTGLR.D140H5N4SN1314,287.9182516
PE000002114R.LSLHRPALEDLLLGSEAN[H5N4S2]LTCTLTGLR.D140H5N4S2N1315,185.3742710
PE000195119R.PALEDLLLGSEAN[H5N4S2]LTCTLTGLR.D140H5N4S2N1314,579.01460
PE001065119R.PALEDLLLGSEAN[H5N5]LTCTLTGLR.D140H5N5N1314,199.90241
PE001062114R.LSLHRPALEDLLLGSEAN[H5N5]LTCTLTGLR.D140H5N5N1314,806.263189
PE000357114R.LSLHRPALEDLLLGSEAN[H5N5F]LTCTLTGLR.D140H5N5FN1314,952.32031
PE001033114R.LSLHRPALEDLLLGSEAN[H5N5FS]LTCTLTGLR.D140H5N5FSN1315,243.41630
PE000841114R.LSLHRPALEDLLLGSEAN[H5N5FS2]LTCTLTGLR.D140H5N5FS2N1315,534.51120
PE000827119R.PALEDLLLGSEAN[H5N5FS2]LTCTLTGLR.D140H5N5FS2N1314,928.15110
PE000777114R.LSLHRPALEDLLLGSEAN[H5N5S]LTCTLTGLR.D140H5N5SN1315,097.358369
PE000830119R.PALEDLLLGSEAN[H5N5S]LTCTLTGLR.D140H5N5SN1314,490.998147
PE001037114R.LSLHRPALEDLLLGSEAN[H5N5S2]LTCTLTGLR.D140H5N5S2N1315,388.45370
PE001109119R.PALEDLLLGSEAN[H5N5S2]LTCTLTGLR.D140H5N5S2N1314,782.09320
PE000792114R.LSLHRPALEDLLLGSEAN[H6N2]LTCTLTGLR.D140H6N2N1314,359.07710
PE001059114R.LSLHRPALEDLLLGSEAN[H6N3]LTCTLTGLR.D140H6N3N1314,562.15721
PE001390119R.PALEDLLLGSEAN[H6N3S]LTCTLTGLR.D140H6N3SN1314,246.89210
PE000773114R.LSLHRPALEDLLLGSEAN[H6N3S]LTCTLTGLR.D140H6N3SN1314,853.25272
PE001058114R.LSLHRPALEDLLLGSEAN[H6N4]LTCTLTGLR.D140H6N4N1314,765.23620
PE001113114R.LSLHRPALEDLLLGSEAN[H6N4F]LTCTLTGLR.D140H6N4FN1314,911.29421
PE001391119R.PALEDLLLGSEAN[H6N4FS]LTCTLTGLR.D140H6N4FSN1314,596.02910
... further results