
From GPTWiki
Revision as of 23:45, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P04004 |description=Vitronectin |gene=VTN |name=VTN |sequence=MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP QVTRGDVFTMPEDEYTVYDDGEEKNNATVHE...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Vitronectin
Gene VTN
Organism Homo sapiens
Species Homo sapiens
GlyGen P04004

Samples (Peptides)

Human Serum (22 / 22)


N86 (3 / 22), N169 (9 / 22), N242 (10 / 22)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups