PE000236

From GPTWiki
Revision as of 20:31, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.LEPVHLQLQCMSQEQLAQVAAN[H5N4S2]ATKEFTEAFLGCPAIHPR.C
Sequence LEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPR
Glycans(s) H5N4S2 (N22)
Mod(s) 57.021 (C10), 57.021 (C34)
Molecular Weight 6755.023
Norm. RT
Protein PGLYRP2 (Q96PD5)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00033172.19072.3991,348.4155OrbitrapHuman Serum15
TG00093476.7331,123.8476OrbitrapHuman Serum13