Revision history of "Q15293"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 18:01, 6 April 2021Edwardsnj talk contribs 451 bytes +451 Created page with "{{Protein |accession=Q15293 |description=Reticulocalbin-1 |gene=RCN1 |name=RCN1 |sequence=MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDH EAFLGKEDSKTFDQLTPDESKERL..."