Q15293

From GPTWiki
Revision as of 18:01, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q15293 |description=Reticulocalbin-1 |gene=RCN1 |name=RCN1 |sequence=MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDH EAFLGKEDSKTFDQLTPDESKERL...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Reticulocalbin-1
Gene RCN1
Organism Homo sapiens
Species Homo sapiens
GlyGen Q15293

Samples (Peptides)

HEK293 Cells (7 / 7)

Sites

N53 (7 / 7)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00191938R.VVRPDSELGERPPEDN[H3N3F]QSFQYDHEAFLGK.E66H3N3FN534,618.05110
PE00127038R.VVRPDSELGERPPEDN[H3N3F]QSFQYDHEAFLGKEDSK.T70H3N3FN535,077.24710
PE00191538R.VVRPDSELGERPPEDN[H3N4F]QSFQYDHEAFLGK.E66H3N4FN534,821.13030
PE00206438R.VVRPDSELGERPPEDN[H3N5F]QSFQYDHEAFLGK.E66H3N5FN535,024.20910
PE00126938R.VVRPDSELGERPPEDN[H5N2]QSFQYDHEAFLGKEDSK.T70H5N2N535,052.21530
PE00191738R.VVRPDSELGERPPEDN[H6N2]QSFQYDHEAFLGK.E66H6N2N534,755.07220
PE00191638R.VVRPDSELGERPPEDN[H7N2]QSFQYDHEAFLGK.E66H7N2N534,917.12510